SCOP 1.69: Domain d1ufla_: 1ufl A:

Lineage for d1ufla_ (1ufl A:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.58: Ferredoxin-like [54861] (49 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.5: GlnB-like [54913] (4 families)
   form timeric structures with the orthogonally packed beta-sheets

5. Family d.58.5.1: Prokaryotic signal transducing protein [54914] (2 proteins)

6. Protein PII (product of glnB) [54915] (5 species)
   trimer with orthogonal packing of beta-sheets around the threefold axis

7. Species Thermus thermophilus [TaxId:274] [102972] (1 PDB entry)

8. Domain d1ufla_: 1ufl A: [99341]

Details for d1ufla_

PDB Entry: 1ufl, 2.7 Å

PDB Description: crystal structure of tt1020 from thermus thermophilus hb8

SCOP Domain Sequences for d1ufla_:

Sequence; same for both SEQRES and ATOM records:

>d1ufla_ d.58.5.1 (A:) PII (product of glnB) {Thermus thermophilus}
mklivaivrpeklnevlkalfqaevrgltlsrvqghggetervetyrgttvkmelhekvr
leigvsepfvkptveailkaartgevgdgkifvlpvekvyrirtgeed

Timeline for d1ufla_:

• d1ufla_ first appeared in SCOP 1.67
  
• d1ufla_ appears in SCOP 1.71
  
• d1ufla_ appears in the current release, SCOPe 2.08