Lineage for d1uflc_ (1ufl C:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 503917Fold d.58: Ferredoxin-like [54861] (49 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 504343Superfamily d.58.5: GlnB-like [54913] (4 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 504344Family d.58.5.1: Prokaryotic signal transducing protein [54914] (2 proteins)
  6. 504345Protein PII (product of glnB) [54915] (5 species)
    trimer with orthogonal packing of beta-sheets around the threefold axis
  7. 504365Species Thermus thermophilus [TaxId:274] [102972] (1 PDB entry)
  8. 504368Domain d1uflc_: 1ufl C: [99343]
    structural genomics

Details for d1uflc_

PDB Entry: 1ufl (more details), 2.7 Å

PDB Description: crystal structure of tt1020 from thermus thermophilus hb8

SCOP Domain Sequences for d1uflc_:

Sequence, based on SEQRES records: (download)

>d1uflc_ d.58.5.1 (C:) PII (product of glnB) {Thermus thermophilus}
mklivaivrpeklnevlkalfqaevrgltlsrvqghggetervetyrgttvkmelhekvr
leigvsepfvkptveailkaartgevgdgkifvlpvekvyrirtgeede

Sequence, based on observed residues (ATOM records): (download)

>d1uflc_ d.58.5.1 (C:) PII (product of glnB) {Thermus thermophilus}
mklivaivrpeklnevlkalfqaevrgltlsrvqghggttvkmelhekvrleigvsepfv
kptveailkaartgevgdgkifvlpvekvyrirtgeede

SCOP Domain Coordinates for d1uflc_:

Click to download the PDB-style file with coordinates for d1uflc_.
(The format of our PDB-style files is described here.)

Timeline for d1uflc_: