Lineage for d1ufla_ (1ufl A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 411877Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 412166Superfamily d.58.5: GlnB-like [54913] (4 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 412167Family d.58.5.1: Prokaryotic signal transducing protein [54914] (2 proteins)
  6. 412168Protein PII (product of glnB) [54915] (5 species)
    trimer with orthogonal packing of beta-sheets around the threefold axis
  7. 412188Species Thermus thermophilus [TaxId:274] [102972] (1 PDB entry)
  8. 412189Domain d1ufla_: 1ufl A: [99341]

Details for d1ufla_

PDB Entry: 1ufl (more details), 2.7 Å

PDB Description: crystal structure of tt1020 from thermus thermophilus hb8

SCOP Domain Sequences for d1ufla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ufla_ d.58.5.1 (A:) PII (product of glnB) {Thermus thermophilus}
mklivaivrpeklnevlkalfqaevrgltlsrvqghggetervetyrgttvkmelhekvr
leigvsepfvkptveailkaartgevgdgkifvlpvekvyrirtgeed

SCOP Domain Coordinates for d1ufla_:

Click to download the PDB-style file with coordinates for d1ufla_.
(The format of our PDB-style files is described here.)

Timeline for d1ufla_: