SCOPe 2.08: Domain d1uelb1: 1uel B:263-307

Lineage for d1uelb1 (1uel B:263-307)

1. Root: SCOPe 2.08

2. Class j: Peptides [58231] (151 folds)

3. Fold j.105: Ubiquitin interacting motif (UIM) [90302] (1 superfamily)

4. Superfamily j.105.1: Ubiquitin interacting motif (UIM) [90303] (1 family)

5. Family j.105.1.1: Ubiquitin interacting motif (UIM) [90304] (2 proteins)
   amphipathic helix

6. Protein 26s proteasome non-ATPase regulatory subunit 4 (s5a) [103756] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [103757] (3 PDB entries)

8. Domain d1uelb1: 1uel B:263-307 [99266]
   Other proteins in same PDB: d1uela1, d1uela2, d1uelb2

Details for d1uelb1

PDB Entry: 1uel

PDB Description: solution structure of ubiquitin-like domain of hhr23b complexed with ubiquitin-interacting motif of proteasome subunit s5a

PDB Compounds: (B:) 26S proteasome non-ATPase regulatory subunit 4

SCOPe Domain Sequences for d1uelb1:

Sequence; same for both SEQRES and ATOM records:

>d1uelb1 j.105.1.1 (B:263-307) 26s proteasome non-ATPase regulatory subunit 4 (s5a) {Human (Homo sapiens) [TaxId: 9606]}
mtisqqefgrtglpdlssmteeeqiayamqmslqgaefgqaesad

Timeline for d1uelb1:

• d1uelb1 first appeared in SCOP 1.67, called d1uelb_
  
• d1uelb1 appears in SCOPe 2.07