Lineage for d1uelb1 (1uel B:263-307)

  1. Root: SCOPe 2.08
  2. Class j: Peptides [58231] (151 folds)
  3. Fold j.105: Ubiquitin interacting motif (UIM) [90302] (1 superfamily)
  4. Superfamily j.105.1: Ubiquitin interacting motif (UIM) [90303] (1 family) (S)
  5. Family j.105.1.1: Ubiquitin interacting motif (UIM) [90304] (2 proteins)
    amphipathic helix
  6. Protein 26s proteasome non-ATPase regulatory subunit 4 (s5a) [103756] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [103757] (3 PDB entries)
  8. Domain d1uelb1: 1uel B:263-307 [99266]
    Other proteins in same PDB: d1uela1, d1uela2, d1uelb2

Details for d1uelb1

PDB Entry: 1uel (more details)

PDB Description: Solution structure of ubiquitin-like domain of hHR23B complexed with ubiquitin-interacting motif of proteasome subunit S5a
PDB Compounds: (B:) 26S proteasome non-ATPase regulatory subunit 4

SCOPe Domain Sequences for d1uelb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uelb1 j.105.1.1 (B:263-307) 26s proteasome non-ATPase regulatory subunit 4 (s5a) {Human (Homo sapiens) [TaxId: 9606]}
mtisqqefgrtglpdlssmteeeqiayamqmslqgaefgqaesad

SCOPe Domain Coordinates for d1uelb1 are not available.

Timeline for d1uelb1:

Domains from same chain:
(mouse over for more information)
d1uelb2
Domains from other chains:
(mouse over for more information)
d1uela1, d1uela2