![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
![]() | Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
![]() | Protein Ubiquitin-like domain of Rad23 homolog B (Hhr23B) [102777] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [102778] (2 PDB entries) Uniprot P54727 1-82 |
![]() | Domain d1uela1: 1uel A:1-87 [99265] Other proteins in same PDB: d1uela2, d1uelb1, d1uelb2 complexed with the C-terminal ubiquitin-interacting motif of the proteasome subunit s5a |
PDB Entry: 1uel (more details)
SCOPe Domain Sequences for d1uela1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uela1 d.15.1.1 (A:1-87) Ubiquitin-like domain of Rad23 homolog B (Hhr23B) {Human (Homo sapiens) [TaxId: 9606]} mqvtlktlqqqtfkididpeetvkalkekiesekgkdafpvagqkliyagkilnddtalk eykideknfvvvmvtkpkavstpapat
Timeline for d1uela1: