SCOP 1.67: Domain d1uelb_: 1uel B:

Lineage for d1uelb_ (1uel B:)

1. Root: SCOP 1.67

2. Class j: Peptides [58231] (111 folds)

3. Fold j.105: Ubiquitin interacting motif (UIM) [90302] (1 superfamily)

4. Superfamily j.105.1: Ubiquitin interacting motif (UIM) [90303] (1 family)

5. Family j.105.1.1: Ubiquitin interacting motif (UIM) [90304] (2 proteins)
   amphipathic helix

6. Protein 26s proteasome non-ATPase regulatory subunit 4 (s5a) [103756] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [103757] (3 PDB entries)

8. Domain d1uelb_: 1uel B: [99266]
   Other proteins in same PDB: d1uela_

Details for d1uelb_

PDB Entry: 1uel

PDB Description: solution structure of ubiquitin-like domain of hhr23b complexed with ubiquitin-interacting motif of proteasome subunit s5a

SCOP Domain Sequences for d1uelb_:

Sequence; same for both SEQRES and ATOM records:

>d1uelb_ j.105.1.1 (B:) 26s proteasome non-ATPase regulatory subunit 4 (s5a) {Human (Homo sapiens)}
gshmtisqqefgrtglpdlssmteeeqiayamqmslqgaefgqaesad

Timeline for d1uelb_:

• d1uelb_ is new in SCOP 1.67
  
• d1uelb_ appears in SCOP 1.69
  
• d1uelb_ appears in the current release, SCOPe 2.08, called d1uelb1