Lineage for d1uejb_ (1uej B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866582Family c.37.1.6: Phosphoribulokinase/pantothenate kinase [52584] (6 proteins)
  6. 2866606Protein Uridine-cytidine kinase 2 [102360] (1 species)
  7. 2866607Species Human (Homo sapiens) [TaxId:9606] [102361] (10 PDB entries)
  8. 2866617Domain d1uejb_: 1uej B: [99264]
    complexed with cit, ctn

Details for d1uejb_

PDB Entry: 1uej (more details), 2.61 Å

PDB Description: Crystal structure of human uridine-cytidine kinase 2 complexed with a substrate, cytidine
PDB Compounds: (B:) Uridine-cytidine kinase 2

SCOPe Domain Sequences for d1uejb_:

Sequence, based on SEQRES records: (download)

>d1uejb_ c.37.1.6 (B:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]}
gepfligvsggtasgkssvcakivqllgqnevdyrqkqvvilsqdsfyrvltseqkakal
kgqfnfdhpdafdnelilktlkeitegktvqipvydfvshsrkeetvtvypadvvlfegi
lafysqevrdlfqmklfvdtdadtrlsrrvlrdisergrdleqilsqyitfvkpafeefc
lptkkyadviiprgadnlvainlivqhiqdiln

Sequence, based on observed residues (ATOM records): (download)

>d1uejb_ c.37.1.6 (B:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]}
gepfligvsggtasgkssvcakivqllgqqkqvvilsqdsfyrvltseqkakalkgqfnf
dhpdafdnelilktlkeitegktvqipvydfvshsrkeetvtvypadvvlfegilafysq
evrdlfqmklfvdtdadtrlsrrvlrdisergrdleqilsqyitfvkpafeefclptkky
adviiprgadnlvainlivqhiqdiln

SCOPe Domain Coordinates for d1uejb_:

Click to download the PDB-style file with coordinates for d1uejb_.
(The format of our PDB-style files is described here.)

Timeline for d1uejb_: