Lineage for d1ueja_ (1uej A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. Family c.37.1.6: Phosphoribulokinase/pantothenate kinase [52584] (6 proteins)
  6. Protein Uridine-cytidine kinase 2 [102360] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [102361] (10 PDB entries)
  8. Domain d1ueja_: 1uej A: [99263]
    complexed with cit, ctn

Details for d1ueja_

PDB Entry: 1uej (more details), 2.61 Å

PDB Description: Crystal structure of human uridine-cytidine kinase 2 complexed with a substrate, cytidine
PDB Compounds: (A:) Uridine-cytidine kinase 2

SCOPe Domain Sequences for d1ueja_:

Sequence, based on SEQRES records: (download)

>d1ueja_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]}
epfligvsggtasgkssvcakivqllgqnevdyrqkqvvilsqdsfyrvltseqkakalk
gqfnfdhpdafdnelilktlkeitegktvqipvydfvshsrkeetvtvypadvvlfegil
afysqevrdlfqmklfvdtdadtrlsrrvlrdisergrdleqilsqyitfvkpafeefcl
ptkkyadviiprgadnlvainlivqhiqdil

Sequence, based on observed residues (ATOM records): (download)

>d1ueja_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]}
epfligvsggtasgkssvcakivqllgqqkqvvilsqdsfyrvltseqkakalkgqfnfd
hpdafdnelilktlkeitegktvqipvydfvshsrkeetvtvypadvvlfegilafysqe
vrdlfqmklfvdtdadtrlsrrvlrdisergrdleqilsqyitfvkpafeefclptkkya
dviiprgadnlvainlivqhiqdil

SCOPe Domain Coordinates for d1ueja_ are not available.

Timeline for d1ueja_:

Domains from other chains:
(mouse over for more information)
d1uejb_