Lineage for d1uejb_ (1uej B:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 393331Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 393332Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 393709Family c.37.1.6: Phosphoribulokinase/pantothenate kinase [52584] (5 proteins)
  6. 393729Protein Uridine-cytidine kinase 2 [102360] (1 species)
  7. 393730Species Human (Homo sapiens) [TaxId:9606] [102361] (5 PDB entries)
  8. 393738Domain d1uejb_: 1uej B: [99264]
    complexed with cit, ctn

Details for d1uejb_

PDB Entry: 1uej (more details), 2.61 Å

PDB Description: Crystal structure of human uridine-cytidine kinase 2 complexed with a substrate, cytidine

SCOP Domain Sequences for d1uejb_:

Sequence, based on SEQRES records: (download)

>d1uejb_ c.37.1.6 (B:) Uridine-cytidine kinase 2 {Human (Homo sapiens)}
gepfligvsggtasgkssvcakivqllgqnevdyrqkqvvilsqdsfyrvltseqkakal
kgqfnfdhpdafdnelilktlkeitegktvqipvydfvshsrkeetvtvypadvvlfegi
lafysqevrdlfqmklfvdtdadtrlsrrvlrdisergrdleqilsqyitfvkpafeefc
lptkkyadviiprgadnlvainlivqhiqdiln

Sequence, based on observed residues (ATOM records): (download)

>d1uejb_ c.37.1.6 (B:) Uridine-cytidine kinase 2 {Human (Homo sapiens)}
gepfligvsggtasgkssvcakivqllgqqkqvvilsqdsfyrvltseqkakalkgqfnf
dhpdafdnelilktlkeitegktvqipvydfvshsrkeetvtvypadvvlfegilafysq
evrdlfqmklfvdtdadtrlsrrvlrdisergrdleqilsqyitfvkpafeefclptkky
adviiprgadnlvainlivqhiqdiln

SCOP Domain Coordinates for d1uejb_:

Click to download the PDB-style file with coordinates for d1uejb_.
(The format of our PDB-style files is described here.)

Timeline for d1uejb_: