SCOPe 2.06: Domain d1ucpa_: 1ucp A:

Lineage for d1ucpa_ (1ucp A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.77: DEATH domain [47985] (1 superfamily)
   6 helices: closed bundle; greek-key; internal pseudo twofold symmetry

4. Superfamily a.77.1: DEATH domain [47986] (5 families)

5. Family a.77.1.5: Pyrin domain, PYD [101298] (3 proteins)
   automatically mapped to Pfam PF02758

6. Protein Apoptosis-associated speck-like protein Asc [101299] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101300] (1 PDB entry)

8. Domain d1ucpa_: 1ucp A: [99186]

Details for d1ucpa_

PDB Entry: 1ucp

PDB Description: nmr structure of the pyrin domain of human asc

PDB Compounds: (A:) Apoptosis-associated speck-like protein containing a CARD

SCOPe Domain Sequences for d1ucpa_:

Sequence; same for both SEQRES and ATOM records:

>d1ucpa_ a.77.1.5 (A:) Apoptosis-associated speck-like protein Asc {Human (Homo sapiens) [TaxId: 9606]}
mgrardaildalenltaeelkkfklkllsvplregygriprgallsmdaldltdklvsfy
letygaeltanvlrdmglqemagqlqaathq

Timeline for d1ucpa_:

• d1ucpa_ first appeared in SCOP 1.67
  
• d1ucpa_ appears in SCOPe 2.05
  
• d1ucpa_ appears in SCOPe 2.07
  
• d1ucpa_ appears in the current release, SCOPe 2.08