Lineage for d1ucpa_ (1ucp A:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 357940Fold a.77: DEATH domain [47985] (1 superfamily)
    6 helices: closed bundle; greek-key; internal pseudo twofold symmetry
  4. 357941Superfamily a.77.1: DEATH domain [47986] (4 families) (S)
  5. 357993Family a.77.1.5: Pyrin domain, PYD [101298] (2 proteins)
  6. 357994Protein Apoptosis-associated speck-like protein Asc [101299] (1 species)
  7. 357995Species Human (Homo sapiens) [TaxId:9606] [101300] (1 PDB entry)
  8. 357996Domain d1ucpa_: 1ucp A: [99186]

Details for d1ucpa_

PDB Entry: 1ucp (more details)

PDB Description: nmr structure of the pyrin domain of human asc

SCOP Domain Sequences for d1ucpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ucpa_ a.77.1.5 (A:) Apoptosis-associated speck-like protein Asc {Human (Homo sapiens)}
mgrardaildalenltaeelkkfklkllsvplregygriprgallsmdaldltdklvsfy
letygaeltanvlrdmglqemagqlqaathq

SCOP Domain Coordinates for d1ucpa_:

Click to download the PDB-style file with coordinates for d1ucpa_.
(The format of our PDB-style files is described here.)

Timeline for d1ucpa_: