Lineage for d1ucpa_ (1ucp A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.77: DEATH domain [47985] (1 superfamily)
    6 helices: closed bundle; greek-key; internal pseudo twofold symmetry
  4. Superfamily a.77.1: DEATH domain [47986] (5 families) (S)
  5. Family a.77.1.5: Pyrin domain, PYD [101298] (3 proteins)
    automatically mapped to Pfam PF02758
  6. Protein Apoptosis-associated speck-like protein Asc [101299] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [101300] (1 PDB entry)
  8. Domain d1ucpa_: 1ucp A: [99186]

Details for d1ucpa_

PDB Entry: 1ucp (more details)

PDB Description: NMR structure of the PYRIN domain of human ASC
PDB Compounds: (A:) Apoptosis-associated speck-like protein containing a CARD

SCOPe Domain Sequences for d1ucpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ucpa_ a.77.1.5 (A:) Apoptosis-associated speck-like protein Asc {Human (Homo sapiens) [TaxId: 9606]}
mgrardaildalenltaeelkkfklkllsvplregygriprgallsmdaldltdklvsfy
letygaeltanvlrdmglqemagqlqaathq

SCOPe Domain Coordinates for d1ucpa_ are not available.

Timeline for d1ucpa_: