Lineage for d1s4zb_ (1s4z B:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 946133Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 947418Superfamily b.34.13: Chromo domain-like [54160] (4 families) (S)
    SH3-like barrel is capped by a C-terminal helix
  5. 947452Family b.34.13.2: Chromo domain [54165] (8 proteins)
    lacks the SH3-like barrel first strand that can be complemented by bound peptide ligand; in shadow chromo domain the corresponding site is altered by insertion; similarity to the IL8-like fold
  6. 947497Protein Heterochromatin protein 1, HP1 [54166] (4 species)
    duplication: consists of two homologous domains, N-terminal chromo domain and C-terminal chromo shadow domain
  7. 947510Species Mouse (Mus musculus), HP1 beta (MOD1, M31) [TaxId:10090] [54167] (5 PDB entries)
  8. 947519Domain d1s4zb_: 1s4z B: [98516]
    Chromo shadow domain complexed with pxvxl motif peptide of caf-1, chain C

Details for d1s4zb_

PDB Entry: 1s4z (more details)

PDB Description: hp1 chromo shadow domain in complex with pxvxl motif of caf-1
PDB Compounds: (B:) chromobox protein homolog 1

SCOPe Domain Sequences for d1s4zb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s4zb_ b.34.13.2 (B:) Heterochromatin protein 1, HP1 {Mouse (Mus musculus), HP1 beta (MOD1, M31) [TaxId: 10090]}
hmkeesekprgfargleperiigatdssgelmflmkwknsdeadlvpakeanvkcpqvvi
sfyeerltwhsypsd

SCOPe Domain Coordinates for d1s4zb_:

Click to download the PDB-style file with coordinates for d1s4zb_.
(The format of our PDB-style files is described here.)

Timeline for d1s4zb_: