Class b: All beta proteins [48724] (174 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.13: Chromo domain-like [54160] (4 families) SH3-like barrel is capped by a C-terminal helix |
Family b.34.13.2: Chromo domain [54165] (8 proteins) lacks the SH3-like barrel first strand that can be complemented by bound peptide ligand; in shadow chromo domain the corresponding site is altered by insertion; similarity to the IL8-like fold |
Protein Heterochromatin protein 1, HP1 [54166] (4 species) duplication: consists of two homologous domains, N-terminal chromo domain and C-terminal chromo shadow domain |
Species Mouse (Mus musculus), HP1 beta (MOD1, M31) [TaxId:10090] [54167] (5 PDB entries) |
Domain d1s4za_: 1s4z A: [98515] Chromo shadow domain complexed with pxvxl motif peptide of caf-1, chain C |
PDB Entry: 1s4z (more details)
SCOPe Domain Sequences for d1s4za_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s4za_ b.34.13.2 (A:) Heterochromatin protein 1, HP1 {Mouse (Mus musculus), HP1 beta (MOD1, M31) [TaxId: 10090]} hmkeesekprgfargleperiigatdssgelmflmkwknsdeadlvpakeanvkcpqvvi sfyeerltwhsypsd
Timeline for d1s4za_: