SCOP 1.75: Domain d1s4zb_: 1s4z B:

Lineage for d1s4zb_ (1s4z B:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.13: Chromo domain-like [54160] (3 families)
   SH3-like barrel is capped by a C-terminal helix

5. Family b.34.13.2: Chromo domain [54165] (7 proteins)
   lacks the SH3-like barrel first strand that can be complemented by bound peptide ligand; in shadow chromo domain the corresponding site is altered by insertion; similarity to the IL8-like fold

6. Protein Heterochromatin protein 1, HP1 [54166] (3 species)
   duplication: consists of two homologous domains, N-terminal chromo domain and C-terminal chromo shadow domain

7. Species Mouse (Mus musculus), HP1 beta (MOD1, M31) [TaxId:10090] [54167] (5 PDB entries)

8. Domain d1s4zb_: 1s4z B: [98516]
   Chromo shadow domain complexed with pxvxl motif peptide of caf-1, chain C

Details for d1s4zb_

PDB Entry: 1s4z

PDB Description: hp1 chromo shadow domain in complex with pxvxl motif of caf-1

PDB Compounds: (B:) chromobox protein homolog 1

SCOP Domain Sequences for d1s4zb_:

Sequence; same for both SEQRES and ATOM records:

>d1s4zb_ b.34.13.2 (B:) Heterochromatin protein 1, HP1 {Mouse (Mus musculus), HP1 beta (MOD1, M31) [TaxId: 10090]}
hmkeesekprgfargleperiigatdssgelmflmkwknsdeadlvpakeanvkcpqvvi
sfyeerltwhsypsd

Timeline for d1s4zb_:

• d1s4zb_ first appeared in SCOP 1.67
  
• d1s4zb_ appears in SCOP 1.73
  
• d1s4zb_ appears in SCOPe 2.01
  
• d1s4zb_ appears in the current release, SCOPe 2.08, called d1s4zb1