SCOPe 2.08: Domain d1s4ea1: 1s4e A:5-180

Lineage for d1s4ea1 (1s4e A:5-180)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.5: GHMP Kinase, N-terminal domain [54232] (7 proteins)

6. Protein Galactokinase [102762] (3 species)

7. Species Pyrococcus furiosus [TaxId:2261] [102764] (1 PDB entry)

8. Domain d1s4ea1: 1s4e A:5-180 [98477]
   Other proteins in same PDB: d1s4ea2, d1s4eb2, d1s4ec2, d1s4ed2, d1s4ee2, d1s4ef2, d1s4eg2, d1s4eh2, d1s4ei2
   complexed with adp, gla, mg

Details for d1s4ea1

PDB Entry: 1s4e, 2.9 Å

PDB Description: pyrococcus furiosus galactokinase in complex with galactose, adp and magnesium

PDB Compounds: (A:) Galactokinase

SCOPe Domain Sequences for d1s4ea1:

Sequence, based on SEQRES records:

>d1s4ea1 d.14.1.5 (A:5-180) Galactokinase {Pyrococcus furiosus [TaxId: 2261]}
tvkspgrvnligehtdytygyvmpmaidlytiitaekydkvqlysehfneektftldnlt
kegswidyvkgvlwvliqegykigglkgkitgdlplgaglsssasfevgilevlnqlynl
nidplkkallakkaenefvgvpcgildqfavvfgkkdnvifldtqtlqyeyipfpk

Sequence, based on observed residues (ATOM records):

>d1s4ea1 d.14.1.5 (A:5-180) Galactokinase {Pyrococcus furiosus [TaxId: 2261]}
tvkspgrvnligehtdytygyvmpmaidlytiitdkvqlysehfnekldltkegswidyv
kgvlwvliqegykigglkkitgdlplgaglsssasfevgilevlnqlynlnidplkkall
akkaenefvgvpcgildqfavvfgkkdnvifldtqtlqyeyipfpk

Timeline for d1s4ea1:

• d1s4ea1 first appeared in SCOP 1.67
  
• d1s4ea1 appears in SCOPe 2.07