| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) ![]() |
| Family d.14.1.5: GHMP Kinase, N-terminal domain [54232] (7 proteins) |
| Protein Galactokinase [102762] (3 species) |
| Species Pyrococcus furiosus [TaxId:2261] [102764] (1 PDB entry) |
| Domain d1s4eg1: 1s4e G:11-179 [98489] Other proteins in same PDB: d1s4ea2, d1s4eb2, d1s4ec2, d1s4ed2, d1s4ee2, d1s4ef2, d1s4eg2, d1s4eh2, d1s4ei2 complexed with adp, gla, mg fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 1s4e (more details), 2.9 Å
SCOPe Domain Sequences for d1s4eg1:
Sequence, based on SEQRES records: (download)
>d1s4eg1 d.14.1.5 (G:11-179) Galactokinase {Pyrococcus furiosus [TaxId: 2261]}
rvnligehtdytygyvmpmaidlytiitaekydkvqlysehfneektftldnltkegswi
dyvkgvlwvliqegykigglkgkitgdlplgaglsssasfevgilevlnqlynlnidplk
kallakkaenefvgvpcgildqfavvfgkkdnvifldtqtlqyeyipfp
>d1s4eg1 d.14.1.5 (G:11-179) Galactokinase {Pyrococcus furiosus [TaxId: 2261]}
rvnligehtdytygyvmpmaidlywidygvlwvliqegydlpsssasevgiledplkkal
lakkaenefvcgildqfavvfgnvifldtqtlqyeyipfp
Timeline for d1s4eg1: