Lineage for d1s4eb2 (1s4e B:181-349)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2954566Superfamily d.58.26: GHMP Kinase, C-terminal domain [55060] (8 families) (S)
    common fold is elaborated with additional secondary structures
  5. 2954628Family d.58.26.7: Galactokinase [103011] (2 proteins)
  6. 2954629Protein Galactokinase [103012] (3 species)
  7. 2954637Species Pyrococcus furiosus [TaxId:2261] [103014] (1 PDB entry)
  8. 2954639Domain d1s4eb2: 1s4e B:181-349 [98480]
    Other proteins in same PDB: d1s4ea1, d1s4eb1, d1s4ec1, d1s4ed1, d1s4ee1, d1s4ef1, d1s4eg1, d1s4eh1, d1s4ei1
    complexed with adp, gla, mg

Details for d1s4eb2

PDB Entry: 1s4e (more details), 2.9 Å

PDB Description: pyrococcus furiosus galactokinase in complex with galactose, adp and magnesium
PDB Compounds: (B:) Galactokinase

SCOPe Domain Sequences for d1s4eb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s4eb2 d.58.26.7 (B:181-349) Galactokinase {Pyrococcus furiosus [TaxId: 2261]}
dvsvlvfytgvkrelasseyaerkriaeeslrilgkesskevtekdlgklpplhrkffsy
ivrenarvlevrdalkegdiekvgkilttahwdlaenyrvsceeldffvkkamelgayga
rltgagfggsaialvdkdkaktigdailreylakfswkakyfvvkpsdg

SCOPe Domain Coordinates for d1s4eb2:

Click to download the PDB-style file with coordinates for d1s4eb2.
(The format of our PDB-style files is described here.)

Timeline for d1s4eb2: