SCOP 1.69: Domain d1rzim1: 1rzi M:2-107

Lineage for d1rzim1 (1rzi M:2-107)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88520] (19 PDB entries)

8. Domain d1rzim1: 1rzi M:2-107 [98190]
   Other proteins in same PDB: d1rzia2, d1rzib1, d1rzib2, d1rzic2, d1rzid1, d1rzid2, d1rzie2, d1rzif1, d1rzif2, d1rzig2, d1rzih1, d1rzih2, d1rzii2, d1rzij1, d1rzij2, d1rzik2, d1rzil1, d1rzil2, d1rzim2, d1rzin1, d1rzin2, d1rzio2, d1rzip1, d1rzip2

Details for d1rzim1

PDB Entry: 1rzi, 2.9 Å

PDB Description: Crystal structure of human anti-HIV-1 gp120-reactive antibody 47e fab

SCOP Domain Sequences for d1rzim1:

Sequence; same for both SEQRES and ATOM records:

>d1rzim1 b.1.1.1 (M:2-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 1}
iqmtqspslsasvgdrvtitcrasqsissylnwyqqkpgkvpklliyaasslqsgvpsrf
sgsgsgtdftltisslqpedfatyycqqsystshtfgqgtkleik

Timeline for d1rzim1:

• d1rzim1 first appeared in SCOP 1.67
  
• d1rzim1 appears in SCOP 1.71
  
• d1rzim1 appears in the current release, SCOPe 2.08