PDB entry 1rzi

View 1rzi on RCSB PDB site
Description: Crystal structure of human anti-HIV-1 gp120-reactive antibody 47e fab
Deposited on 2003-12-24, released 2004-02-03
The last revision prior to the SCOP 1.69 freeze date was dated 2004-03-16, with a file datestamp of 2004-03-16.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.233
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rziA (A:)
    diqmtqspslsasvgdrvtitcrasqsissylnwyqqkpgkvpklliyaasslqsgvpsr
    fsgsgsgtdftltisslqpedfatyycqqsystshtfgqgtkleikrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rziA (A:)
    iqmtqspslsasvgdrvtitcrasqsissylnwyqqkpgkvpklliyaasslqsgvpsrf
    sgsgsgtdftltisslqpedfatyycqqsystshtfgqgtkleikrtvaapsvfifppsd
    eqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltls
    kadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rziB (B:)
    qvqllqsgaevkkpgssvkvsckasggtfssyaiswvrqapgqglewmggiipvfgsany
    aqkfqgrvtitadeatsttymelsslrsedtavyfcakggedgdylsdpfyynhgmdvwg
    qgttvtvasastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvh
    tfpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rziB (B:)
    qvqllqsgaevkkpgssvkvsckasggtfssyaiswvrqapgqglewmggiipvfgsany
    aqkfqgrvtitadeatsttymelsslrsedtavyfcakgghgmdvwgqgttvtvasastk
    gpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglys
    lssvvtvpssslgtqtyicnvnhkpsntkvdkkvep
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rziC (C:)
    diqmtqspslsasvgdrvtitcrasqsissylnwyqqkpgkvpklliyaasslqsgvpsr
    fsgsgsgtdftltisslqpedfatyycqqsystshtfgqgtkleikrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1rziD (D:)
    qvqllqsgaevkkpgssvkvsckasggtfssyaiswvrqapgqglewmggiipvfgsany
    aqkfqgrvtitadeatsttymelsslrsedtavyfcakggedgdylsdpfyynhgmdvwg
    qgttvtvasastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvh
    tfpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rziD (D:)
    qvqllqsgaevkkpgssvkvsckasggtfssyaiswvrqapgqglewmggiipvfgsany
    aqkfqgrvtitadeatsttymelsslrsedtavyfcakgghgmdvwgqgttvtvasastk
    gpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglys
    lssvvtvpssslgtqtyicnvnhkpsntkvdkkvep
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1rziE (E:)
    diqmtqspslsasvgdrvtitcrasqsissylnwyqqkpgkvpklliyaasslqsgvpsr
    fsgsgsgtdftltisslqpedfatyycqqsystshtfgqgtkleikrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rziE (E:)
    iqmtqspslsasvgdrvtitcrasqsissylnwyqqkpgkvpklliyaasslqsgvpsrf
    sgsgsgtdftltisslqpedfatyycqqsystshtfgqgtkleikrtvaapsvfifppsd
    eqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltls
    kadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1rziF (F:)
    qvqllqsgaevkkpgssvkvsckasggtfssyaiswvrqapgqglewmggiipvfgsany
    aqkfqgrvtitadeatsttymelsslrsedtavyfcakggedgdylsdpfyynhgmdvwg
    qgttvtvasastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvh
    tfpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rziF (F:)
    qvqllqsgaevkkpgssvkvsckasggtfssyaiswvrqapgqglewmggiipvfgsany
    aqkfqgrvtitadeatsttymelsslrsedtavyfcakgghgmdvwgqgttvtvasastk
    gpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglys
    lssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1rziG (G:)
    diqmtqspslsasvgdrvtitcrasqsissylnwyqqkpgkvpklliyaasslqsgvpsr
    fsgsgsgtdftltisslqpedfatyycqqsystshtfgqgtkleikrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rziG (G:)
    iqmtqspslsasvgdrvtitcrasqsissylnwyqqkpgkvpklliyaasslqsgvpsrf
    sgsgsgtdftltisslqpedfatyycqqsystshtfgqgtkleikrtvaapsvfifppsd
    eqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltls
    kadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1rziH (H:)
    qvqllqsgaevkkpgssvkvsckasggtfssyaiswvrqapgqglewmggiipvfgsany
    aqkfqgrvtitadeatsttymelsslrsedtavyfcakggedgdylsdpfyynhgmdvwg
    qgttvtvasastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvh
    tfpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rziH (H:)
    qvqllqsgaevkkpgssvkvsckasggtfssyaiswvrqapgqglewmggiipvfgsany
    aqkfqgrvtitadeatsttymelsslrsedtavyfcakgghgmdvwgqgttvtvasastk
    gpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglys
    lssvvtvpssslgtqtyicnvnhkpsntkvdkkvep
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1rziI (I:)
    diqmtqspslsasvgdrvtitcrasqsissylnwyqqkpgkvpklliyaasslqsgvpsr
    fsgsgsgtdftltisslqpedfatyycqqsystshtfgqgtkleikrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rziI (I:)
    iqmtqspslsasvgdrvtitcrasqsissylnwyqqkpgkvpklliyaasslqsgvpsrf
    sgsgsgtdftltisslqpedfatyycqqsystshtfgqgtkleikrtvaapsvfifppsd
    eqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltls
    kadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1rziJ (J:)
    qvqllqsgaevkkpgssvkvsckasggtfssyaiswvrqapgqglewmggiipvfgsany
    aqkfqgrvtitadeatsttymelsslrsedtavyfcakggedgdylsdpfyynhgmdvwg
    qgttvtvasastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvh
    tfpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rziJ (J:)
    qvqllqsgaevkkpgssvkvsckasggtfssyaiswvrqapgqglewmggiipvfgsany
    aqkfqgrvtitadeatsttymelsslrsedtavyfcakgghgmdvwgqgttvtvasastk
    gpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglys
    lssvvtvpssslgtqtyicnvnhkpsntkvdkkvep
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1rziK (K:)
    diqmtqspslsasvgdrvtitcrasqsissylnwyqqkpgkvpklliyaasslqsgvpsr
    fsgsgsgtdftltisslqpedfatyycqqsystshtfgqgtkleikrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rziK (K:)
    iqmtqspslsasvgdrvtitcrasqsissylnwyqqkpgkvpklliyaasslqsgvpsrf
    sgsgsgtdftltisslqpedfatyycqqsystshtfgqgtkleikrtvaapsvfifppsd
    eqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltls
    kadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1rziL (L:)
    qvqllqsgaevkkpgssvkvsckasggtfssyaiswvrqapgqglewmggiipvfgsany
    aqkfqgrvtitadeatsttymelsslrsedtavyfcakggedgdylsdpfyynhgmdvwg
    qgttvtvasastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvh
    tfpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rziL (L:)
    qvqllqsgaevkkpgssvkvsckasggtfssyaiswvrqapgqglewmggiipvfgsany
    aqkfqgrvtitadeatsttymelsslrsedtavyfcakghgmdvwgqgttvtvasastkg
    psvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysl
    ssvvtvpssslgtqtyicnvnhkpsntkvdkkvep
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1rziM (M:)
    diqmtqspslsasvgdrvtitcrasqsissylnwyqqkpgkvpklliyaasslqsgvpsr
    fsgsgsgtdftltisslqpedfatyycqqsystshtfgqgtkleikrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rziM (M:)
    iqmtqspslsasvgdrvtitcrasqsissylnwyqqkpgkvpklliyaasslqsgvpsrf
    sgsgsgtdftltisslqpedfatyycqqsystshtfgqgtkleikrtvaapsvfifppsd
    eqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltls
    kadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1rziN (N:)
    qvqllqsgaevkkpgssvkvsckasggtfssyaiswvrqapgqglewmggiipvfgsany
    aqkfqgrvtitadeatsttymelsslrsedtavyfcakggedgdylsdpfyynhgmdvwg
    qgttvtvasastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvh
    tfpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rziN (N:)
    qvqllqsgaevkkpgssvkvsckasggtfssyaiswvrqapgqglewmggiipvfgsany
    aqkfqgrvtitadeatsttymelsslrsedtavyfcakgghgmdvwgqgttvtvasastk
    gpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglys
    lssvvtvpssslgtqtyicnvnhkpsntkvdkkvep
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1rziO (O:)
    diqmtqspslsasvgdrvtitcrasqsissylnwyqqkpgkvpklliyaasslqsgvpsr
    fsgsgsgtdftltisslqpedfatyycqqsystshtfgqgtkleikrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rziO (O:)
    iqmtqspslsasvgdrvtitcrasqsissylnwyqqkpgkvpklliyaasslqsgvpsrf
    sgsgsgtdftltisslqpedfatyycqqsystshtfgqgtkleikrtvaapsvfifppsd
    eqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltls
    kadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >1rziP (P:)
    qvqllqsgaevkkpgssvkvsckasggtfssyaiswvrqapgqglewmggiipvfgsany
    aqkfqgrvtitadeatsttymelsslrsedtavyfcakggedgdylsdpfyynhgmdvwg
    qgttvtvasastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvh
    tfpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rziP (P:)
    qvqllqsgaevkkpgssvkvsckasggtfssyaiswvrqapgqglewmggiipvfgsany
    aqkfqgrvtitadeatsttymelsslrsedtavyfcakgghgmdvwgqgttvtvasastk
    gpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglys
    lssvvtvpssslgtqtyicnvnhkpsntkvdkkvep