Lineage for d1rxwa2 (1rxw A:3-219)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 404812Fold c.120: PIN domain-like [88722] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145
  4. 404813Superfamily c.120.1: PIN domain-like [88723] (2 families) (S)
  5. 404840Family c.120.1.2: 5' to 3' exonuclease catalytic domain [53045] (4 proteins)
    contains an alpha-helical arch and additional strand 6 antiparallel to the rest; strand order 321456; similarity to the resolvase-like fold
  6. 404847Protein Flap endonuclease-1 (Fen-1 nuclease) [53052] (4 species)
  7. 404848Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [102272] (2 PDB entries)
  8. 404849Domain d1rxwa2: 1rxw A:3-219 [98060]
    Other proteins in same PDB: d1rxwa1

Details for d1rxwa2

PDB Entry: 1rxw (more details), 2 Å

PDB Description: Crystal structure of A. fulgidus FEN-1 bound to DNA

SCOP Domain Sequences for d1rxwa2:

Sequence, based on SEQRES records: (download)

>d1rxwa2 c.120.1.2 (A:3-219) Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Archaeoglobus fulgidus}
adigdlfereeveleyfsgkkiavdafntlyqfisiirqpdgtplkdsqgritshlsgil
yrvsnmvevgirpvfvfdgeppefkkaeieerkkrraeaeemwiaalqagdkdakkyaqa
agrvdeyivdsaktllsymgipfvdapsegeaqaaymaakgdveytgsqdydsllfgspr
larnlaitgkrklpgknvyvdvkpeiiilesnlkrlg

Sequence, based on observed residues (ATOM records): (download)

>d1rxwa2 c.120.1.2 (A:3-219) Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Archaeoglobus fulgidus}
adigdlfereeveleyfsgkkiavdafntlyqfisiirqpdgtplkdsqgritshlsgil
yrvsnmvevgirpvfvfdgeppefkkaeieerkkrraeaeemwiaalqagdkdakkyaqa
agrvdeyivdsaktllsymgipfvdapsegeaqaaymaakgdveytgsqdydsllfgspr
larnlaidvkpeiiilesnlkrlg

SCOP Domain Coordinates for d1rxwa2:

Click to download the PDB-style file with coordinates for d1rxwa2.
(The format of our PDB-style files is described here.)

Timeline for d1rxwa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rxwa1