SCOP 1.67: Domain d1rxwa1: 1rxw A:220-324

Lineage for d1rxwa1 (1rxw A:220-324)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.60: SAM domain-like [47768] (13 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.7: 5' to 3' exonuclease, C-terminal subdomain [47807] (1 family)

5. Family a.60.7.1: 5' to 3' exonuclease, C-terminal subdomain [47808] (4 proteins)

6. Protein Flap endonuclease-1 (Fen-1 nuclease) [47815] (4 species)

7. Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [101255] (2 PDB entries)

8. Domain d1rxwa1: 1rxw A:220-324 [98059]
   Other proteins in same PDB: d1rxwa2

Details for d1rxwa1

PDB Entry: 1rxw, 2 Å

PDB Description: Crystal structure of A. fulgidus FEN-1 bound to DNA

SCOP Domain Sequences for d1rxwa1:

Sequence, based on SEQRES records:

>d1rxwa1 a.60.7.1 (A:220-324) Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Archaeoglobus fulgidus}
ltreqlidiailvgtdynegvkgvgvkkalnyiktygdifralkalkvnidhveeirnff
lnppvtddyriefrepdfekaieflceehdfsrervekaleklka

Sequence, based on observed residues (ATOM records):

>d1rxwa1 a.60.7.1 (A:220-324) Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Archaeoglobus fulgidus}
ltreqlidiailvgtdynegvkgvgvkkalnyiktygdifralkalkvveeirnfflnpp
vtddyriefrepdfekaieflceehdfsrervekaleklka

Timeline for d1rxwa1:

• d1rxwa1 is new in SCOP 1.67
  
• d1rxwa1 appears in SCOP 1.69
  
• d1rxwa1 appears in the current release, SCOPe 2.08