PDB entry 1rxw

View 1rxw on RCSB PDB site
Description: Crystal structure of A. fulgidus FEN-1 bound to DNA
Deposited on 2003-12-18, released 2004-01-27
The last revision prior to the SCOP 1.67 freeze date was dated 2004-01-27, with a file datestamp of 2004-01-27.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.242
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rxwA (A:)
    mgadigdlfereeveleyfsgkkiavdafntlyqfisiirqpdgtplkdsqgritshlsg
    ilyrvsnmvevgirpvfvfdgeppefkkaeieerkkrraeaeemwiaalqagdkdakkya
    qaagrvdeyivdsaktllsymgipfvdapsegeaqaaymaakgdveytgsqdydsllfgs
    prlarnlaitgkrklpgknvyvdvkpeiiilesnlkrlgltreqlidiailvgtdynegv
    kgvgvkkalnyiktygdifralkalkvnidhveeirnfflnppvtddyriefrepdfeka
    ieflceehdfsrervekaleklkalkstqatlerwf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rxwA (A:)
    adigdlfereeveleyfsgkkiavdafntlyqfisiirqpdgtplkdsqgritshlsgil
    yrvsnmvevgirpvfvfdgeppefkkaeieerkkrraeaeemwiaalqagdkdakkyaqa
    agrvdeyivdsaktllsymgipfvdapsegeaqaaymaakgdveytgsqdydsllfgspr
    larnlaidvkpeiiilesnlkrlgltreqlidiailvgtdynegvkgvgvkkalnyikty
    gdifralkalkvveeirnfflnppvtddyriefrepdfekaieflceehdfsrervekal
    eklka