![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.120: PIN domain-like [88722] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.120.1: PIN domain-like [88723] (4 families) ![]() |
![]() | Family c.120.1.2: 5' to 3' exonuclease catalytic domain [53045] (4 proteins) contains an alpha-helical arch and additional strand 6 antiparallel to the rest; strand order 321456; similarity to the resolvase-like fold |
![]() | Protein Flap endonuclease-1 (Fen-1 nuclease) [53052] (5 species) |
![]() | Species Archaeoglobus fulgidus [TaxId:2234] [102272] (2 PDB entries) |
![]() | Domain d1rxwa2: 1rxw A:3-219 [98060] Other proteins in same PDB: d1rxwa1 protein/DNA complex missing some secondary structures that made up less than one-third of the common domain |
PDB Entry: 1rxw (more details), 2 Å
SCOPe Domain Sequences for d1rxwa2:
Sequence, based on SEQRES records: (download)
>d1rxwa2 c.120.1.2 (A:3-219) Flap endonuclease-1 (Fen-1 nuclease) {Archaeoglobus fulgidus [TaxId: 2234]} adigdlfereeveleyfsgkkiavdafntlyqfisiirqpdgtplkdsqgritshlsgil yrvsnmvevgirpvfvfdgeppefkkaeieerkkrraeaeemwiaalqagdkdakkyaqa agrvdeyivdsaktllsymgipfvdapsegeaqaaymaakgdveytgsqdydsllfgspr larnlaitgkrklpgknvyvdvkpeiiilesnlkrlg
>d1rxwa2 c.120.1.2 (A:3-219) Flap endonuclease-1 (Fen-1 nuclease) {Archaeoglobus fulgidus [TaxId: 2234]} adigdlfereeveleyfsgkkiavdafntlyqfisiirqpdgtplkdsqgritshlsgil yrvsnmvevgirpvfvfdgeppefkkaeieerkkrraeaeemwiaalqagdkdakkyaqa agrvdeyivdsaktllsymgipfvdapsegeaqaaymaakgdveytgsqdydsllfgspr larnlaidvkpeiiilesnlkrlg
Timeline for d1rxwa2: