Lineage for d1roca_ (1roc A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1112427Superfamily b.1.22: ASF1-like [101546] (1 family) (S)
    contains extra C-terminal strand
  5. 1112428Family b.1.22.1: ASF1-like [101547] (2 proteins)
  6. 1112429Protein Anti-silencing protein 1, ASF1 [101548] (3 species)
  7. 1112430Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [101549] (3 PDB entries)
  8. 1112431Domain d1roca_: 1roc A: [97673]
    complexed with br

Details for d1roca_

PDB Entry: 1roc (more details), 1.5 Å

PDB Description: Crystal structure of the histone deposition protein Asf1
PDB Compounds: (A:) Anti-silencing protein 1

SCOPe Domain Sequences for d1roca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1roca_ b.1.22.1 (A:) Anti-silencing protein 1, ASF1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gasivsllgikvlnnpakftdpyefeitfecleslkhdlewkltyvgssrsldhdqelds
ilvgpvpvgvnkfvfsadppsaelipaselvsvtvillscsydgrefvrvgyyvnneyde
eelrenppakvqvdhivrnilaekprvtrfnivwd

SCOPe Domain Coordinates for d1roca_:

Click to download the PDB-style file with coordinates for d1roca_.
(The format of our PDB-style files is described here.)

Timeline for d1roca_: