Lineage for d1roca1 (1roc A:2-154)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2766651Superfamily b.1.22: ASF1-like [101546] (2 families) (S)
    contains extra C-terminal strand
    automatically mapped to Pfam PF04729
  5. 2766652Family b.1.22.1: ASF1-like [101547] (2 proteins)
  6. 2766653Protein Anti-silencing protein 1, ASF1 [101548] (3 species)
  7. 2766654Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [101549] (3 PDB entries)
  8. 2766655Domain d1roca1: 1roc A:2-154 [97673]
    Other proteins in same PDB: d1roca2
    complexed with br

Details for d1roca1

PDB Entry: 1roc (more details), 1.5 Å

PDB Description: Crystal structure of the histone deposition protein Asf1
PDB Compounds: (A:) Anti-silencing protein 1

SCOPe Domain Sequences for d1roca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1roca1 b.1.22.1 (A:2-154) Anti-silencing protein 1, ASF1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sivsllgikvlnnpakftdpyefeitfecleslkhdlewkltyvgssrsldhdqeldsil
vgpvpvgvnkfvfsadppsaelipaselvsvtvillscsydgrefvrvgyyvnneydeee
lrenppakvqvdhivrnilaekprvtrfnivwd

SCOPe Domain Coordinates for d1roca1:

Click to download the PDB-style file with coordinates for d1roca1.
(The format of our PDB-style files is described here.)

Timeline for d1roca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1roca2