PDB entry 1roc

View 1roc on RCSB PDB site
Description: Crystal structure of the histone deposition protein Asf1
Class: replication, chaperone
Keywords: beta-sandwich, REPLICATION, CHAPERONE
Deposited on 2003-12-02, released 2003-12-23
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.2
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Anti-silencing protein 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ASF1, YJL115W, J0755
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32447 (2-154)
      • cloning artifact (0-1)
    Domains in SCOPe 2.02: d1roca_
  • Heterogens: BR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rocA (A:)
    gasivsllgikvlnnpakftdpyefeitfecleslkhdlewkltyvgssrsldhdqelds
    ilvgpvpvgvnkfvfsadppsaelipaselvsvtvillscsydgrefvrvgyyvnneyde
    eelrenppakvqvdhivrnilaekprvtrfnivwd