Lineage for d1rkva_ (1rkv A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 495850Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 495851Superfamily c.108.1: HAD-like [56784] (16 families) (S)
    contains an insert alpha+beta subdomain; similar overall fold to the Cof family
    usually contains an insertion (sub)domain after strand 1
  5. 495994Family c.108.1.11: Homoserine kinase ThrH [102304] (1 protein)
    the insertion subdomain is a rudiment 4-helical bundle
  6. 495995Protein Homoserine kinase ThrH [102305] (1 species)
  7. 495996Species Pseudomonas aeruginosa [TaxId:287] [102306] (2 PDB entries)
  8. 495999Domain d1rkva_: 1rkv A: [97629]

Details for d1rkva_

PDB Entry: 1rkv (more details), 1.9 Å

PDB Description: structure of phosphate complex of thrh from pseudomonas aeruginosa

SCOP Domain Sequences for d1rkva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rkva_ c.108.1.11 (A:) Homoserine kinase ThrH {Pseudomonas aeruginosa}
dmeiacldlegvlvpeiwiafaektgidalkattrdipdydvlmkqrlrildehglklgd
iqeviatlkplegavefvdwlrerfqvvilsdtfyefsqplmrqlgfptllchkleidds
drvvgyqlrqkdpkrqsviafkslyyrviaagdsyndttmlseahagilfhapenviref
pqfpavhtyedlkreflkassrslsl

SCOP Domain Coordinates for d1rkva_:

Click to download the PDB-style file with coordinates for d1rkva_.
(The format of our PDB-style files is described here.)

Timeline for d1rkva_: