![]() | Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
![]() | Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.108.1: HAD-like [56784] (16 families) ![]() contains an insert alpha+beta subdomain; similar overall fold to the Cof family usually contains an insertion (sub)domain after strand 1 |
![]() | Family c.108.1.11: Homoserine kinase ThrH [102304] (1 protein) the insertion subdomain is a rudiment 4-helical bundle |
![]() | Protein Homoserine kinase ThrH [102305] (1 species) |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [102306] (2 PDB entries) |
![]() | Domain d1rkvb_: 1rkv B: [97630] |
PDB Entry: 1rkv (more details), 1.9 Å
SCOP Domain Sequences for d1rkvb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rkvb_ c.108.1.11 (B:) Homoserine kinase ThrH {Pseudomonas aeruginosa} dmeiacldlegvlvpeiwiafaektgidalkattrdipdydvlmkqrlrildehglklgd iqeviatlkplegavefvdwlrerfqvvilsdtfyefsqplmrqlgfptllchkleidds drvvgyqlrqkdpkrqsviafkslyyrviaagdsyndttmlseahagilfhapenviref pqfpavhtyedlkreflkassrslsl
Timeline for d1rkvb_: