Lineage for d1rkva1 (1rkv A:1-205)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919479Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2919480Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2920038Family c.108.1.11: Homoserine kinase ThrH [102304] (1 protein)
    the insertion subdomain is a rudiment 4-helical bundle
    automatically mapped to Pfam PF12710
  6. 2920039Protein Homoserine kinase ThrH [102305] (1 species)
  7. 2920040Species Pseudomonas aeruginosa [TaxId:287] [102306] (2 PDB entries)
  8. 2920043Domain d1rkva1: 1rkv A:1-205 [97629]
    Other proteins in same PDB: d1rkva2, d1rkvb2
    complexed with edo, mg, po4

Details for d1rkva1

PDB Entry: 1rkv (more details), 1.9 Å

PDB Description: structure of phosphate complex of thrh from pseudomonas aeruginosa
PDB Compounds: (A:) homoserine kinase

SCOPe Domain Sequences for d1rkva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rkva1 c.108.1.11 (A:1-205) Homoserine kinase ThrH {Pseudomonas aeruginosa [TaxId: 287]}
meiacldlegvlvpeiwiafaektgidalkattrdipdydvlmkqrlrildehglklgdi
qeviatlkplegavefvdwlrerfqvvilsdtfyefsqplmrqlgfptllchkleiddsd
rvvgyqlrqkdpkrqsviafkslyyrviaagdsyndttmlseahagilfhapenvirefp
qfpavhtyedlkreflkassrslsl

SCOPe Domain Coordinates for d1rkva1:

Click to download the PDB-style file with coordinates for d1rkva1.
(The format of our PDB-style files is described here.)

Timeline for d1rkva1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rkva2