SCOPe 2.06: Domain d1rf8b1: 1rf8 B:217-314

Lineage for d1rf8b1 (1rf8 B:217-314)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.210: Eukaryotic initiation factor 4f subunit eIF4g, eIF4e-binding domain [101488] (1 superfamily)
   5 helices, non-globular array; wraps around the N-terminal tail of its target

4. Superfamily a.210.1: Eukaryotic initiation factor 4f subunit eIF4g, eIF4e-binding domain [101489] (1 family)
   not a true superfamily

5. Family a.210.1.1: Eukaryotic initiation factor 4f subunit eIF4g, eIF4e-binding domain [101490] (1 protein)

6. Protein Eukaryotic initiation factor 4f subunit eIF4g, eIF4e-binding domain [101491] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [101492] (1 PDB entry)

8. Domain d1rf8b1: 1rf8 B:217-314 [97371]
   Other proteins in same PDB: d1rf8a_, d1rf8b2
   complexed with m7g, mtn

Details for d1rf8b1

PDB Entry: 1rf8

PDB Description: Solution structure of the yeast translation initiation factor eIF4E in complex with m7GDP and eIF4GI residues 393 to 490

PDB Compounds: (B:) Eukaryotic initiation factor 4F subunit p150

SCOPe Domain Sequences for d1rf8b1:

Sequence; same for both SEQRES and ATOM records:

>d1rf8b1 a.210.1.1 (B:217-314) Eukaryotic initiation factor 4f subunit eIF4g, eIF4e-binding domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
igleaeietttdetddgtntvshilnvlkdatpiedvfsfnypegiegpdikykkehvky
tygptfllqfkdklnvkadaewvqstaskivippgmgr

Timeline for d1rf8b1:

• d1rf8b1 first appeared in SCOP 1.67, called d1rf8b_
  
• d1rf8b1 was called d1rf8b_ in SCOPe 2.05
  
• d1rf8b1 appears in SCOPe 2.07
  
• d1rf8b1 appears in the current release, SCOPe 2.08