SCOP 1.67: Domain d1rf8b_: 1rf8 B:

Lineage for d1rf8b_ (1rf8 B:)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.210: Eukaryotic initiation factor 4f subunit eIF4g, eIF4e-binding domain [101488] (1 superfamily)
   5 helices, non-globular array; wraps around the N-terminal tail of its target

4. Superfamily a.210.1: Eukaryotic initiation factor 4f subunit eIF4g, eIF4e-binding domain [101489] (1 family)
   not a true superfamily

5. Family a.210.1.1: Eukaryotic initiation factor 4f subunit eIF4g, eIF4e-binding domain [101490] (1 protein)

6. Protein Eukaryotic initiation factor 4f subunit eIF4g, eIF4e-binding domain [101491] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [101492] (1 PDB entry)

8. Domain d1rf8b_: 1rf8 B: [97371]
   Other proteins in same PDB: d1rf8a_
   complexed with m7g, mtn

Details for d1rf8b_

PDB Entry: 1rf8

PDB Description: Solution structure of the yeast translation initiation factor eIF4E in complex with m7GDP and eIF4GI residues 393 to 490

SCOP Domain Sequences for d1rf8b_:

Sequence; same for both SEQRES and ATOM records:

>d1rf8b_ a.210.1.1 (B:) Eukaryotic initiation factor 4f subunit eIF4g, eIF4e-binding domain {Baker's yeast (Saccharomyces cerevisiae)}
gsigleaeietttdetddgtntvshilnvlkdatpiedvfsfnypegiegpdikykkehv
kytygptfllqfkdklnvkadaewvqstaskivippgmgr

Timeline for d1rf8b_:

• d1rf8b_ is new in SCOP 1.67
  
• d1rf8b_ appears in SCOP 1.69
  
• d1rf8b_ appears in the current release, SCOPe 2.08, called d1rf8b1