PDB entry 1rf8

View 1rf8 on RCSB PDB site
Description: Solution structure of the yeast translation initiation factor eIF4E in complex with m7GDP and eIF4GI residues 393 to 490
Deposited on 2003-11-07, released 2003-12-23
The last revision prior to the SCOP 1.67 freeze date was dated 2003-12-23, with a file datestamp of 2003-12-23.
Experiment type: NMR11
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1rf8a_
  • Chain 'B':
    Domains in SCOP 1.67: d1rf8b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rf8A (A:)
    msveevskkfeenvsvddttatpktvlsdsahfdvkhplntkwtlwytkpavdkseswsd
    llrpvtsfqtveefwaiiqnipephelplksdyhvfrndvrpewedeanakggkwsfqlc
    gkgadidelwlctllavigetideddsqingvvlsirkggnkfalwtkcedkepllrigg
    kfkqvlkltddghleffphcsangrhpqpsitl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rf8B (B:)
    gsigleaeietttdetddgtntvshilnvlkdatpiedvfsfnypegiegpdikykkehv
    kytygptfllqfkdklnvkadaewvqstaskivippgmgr