Lineage for d1rf8b1 (1rf8 B:217-314)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014829Fold a.210: Eukaryotic initiation factor 4f subunit eIF4g, eIF4e-binding domain [101488] (1 superfamily)
    5 helices, non-globular array; wraps around the N-terminal tail of its target
  4. 2014830Superfamily a.210.1: Eukaryotic initiation factor 4f subunit eIF4g, eIF4e-binding domain [101489] (1 family) (S)
    not a true superfamily
  5. 2014831Family a.210.1.1: Eukaryotic initiation factor 4f subunit eIF4g, eIF4e-binding domain [101490] (1 protein)
  6. 2014832Protein Eukaryotic initiation factor 4f subunit eIF4g, eIF4e-binding domain [101491] (1 species)
  7. 2014833Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [101492] (1 PDB entry)
  8. 2014834Domain d1rf8b1: 1rf8 B:217-314 [97371]
    Other proteins in same PDB: d1rf8a_, d1rf8b2
    complexed with m7g, mtn

Details for d1rf8b1

PDB Entry: 1rf8 (more details)

PDB Description: Solution structure of the yeast translation initiation factor eIF4E in complex with m7GDP and eIF4GI residues 393 to 490
PDB Compounds: (B:) Eukaryotic initiation factor 4F subunit p150

SCOPe Domain Sequences for d1rf8b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rf8b1 a.210.1.1 (B:217-314) Eukaryotic initiation factor 4f subunit eIF4g, eIF4e-binding domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
igleaeietttdetddgtntvshilnvlkdatpiedvfsfnypegiegpdikykkehvky
tygptfllqfkdklnvkadaewvqstaskivippgmgr

SCOPe Domain Coordinates for d1rf8b1:

Click to download the PDB-style file with coordinates for d1rf8b1.
(The format of our PDB-style files is described here.)

Timeline for d1rf8b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rf8b2
View in 3D
Domains from other chains:
(mouse over for more information)
d1rf8a_