SCOPe 2.01: Domain d1rc2b_: 1rc2 B:

Lineage for d1rc2b_ (1rc2 B:)

1. Root: SCOPe 2.01

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.19: Aquaporin-like [81339] (1 superfamily)
   core: 8 helices, 2 short helices are surrounded by 6 long transmembrane helices

4. Superfamily f.19.1: Aquaporin-like [81338] (2 families)

5. Family f.19.1.1: Aquaporin-like [56895] (5 proteins)
   duplication: consist of two similar structural parts

6. Protein Aquaporin Z [103470] (1 species)

7. Species Escherichia coli [TaxId:562] [103471] (6 PDB entries)

8. Domain d1rc2b_: 1rc2 B: [97282]
   complexed with bgl

Details for d1rc2b_

PDB Entry: 1rc2, 2.5 Å

PDB Description: 2.5 angstrom resolution x-ray structure of aquaporin z

PDB Compounds: (B:) Aquaporin Z

SCOPe Domain Sequences for d1rc2b_:

Sequence; same for both SEQRES and ATOM records:

>d1rc2b_ f.19.1.1 (B:) Aquaporin Z {Escherichia coli [TaxId: 562]}
mfrklaaecfgtfwlvfggcgsavlaagfpelgigfagvalafgltvltmafavghisgg
hfnpavtiglwaggrfpakevvgyviaqvvggivaaallyliasgktgfdaaasgfasng
ygehspggysmlsalvvelvlsagfllvihgatdkfapagfapiaiglaltlihlisipv
tntsvnparstavaifqggwaleqlwffwvvpivggiiggliyrtllekrd

Timeline for d1rc2b_:

• d1rc2b_ first appeared in SCOP 1.67
  
• d1rc2b_ appears in SCOP 1.75
  
• d1rc2b_ appears in SCOPe 2.02
  
• d1rc2b_ appears in the current release, SCOPe 2.08