Lineage for d1rc2b_ (1rc2 B:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024308Fold f.19: Aquaporin-like [81339] (1 superfamily)
    core: 8 helices, 2 short helices are surrounded by 6 long transmembrane helices
  4. 3024309Superfamily f.19.1: Aquaporin-like [81338] (2 families) (S)
  5. 3024310Family f.19.1.1: Aquaporin-like [56895] (5 proteins)
    duplication: consist of two similar structural parts
    automatically mapped to Pfam PF00230
  6. 3024311Protein Aquaporin Z [103470] (1 species)
  7. 3024312Species Escherichia coli [TaxId:562] [103471] (6 PDB entries)
  8. 3024320Domain d1rc2b_: 1rc2 B: [97282]
    complexed with bgl

Details for d1rc2b_

PDB Entry: 1rc2 (more details), 2.5 Å

PDB Description: 2.5 angstrom resolution x-ray structure of aquaporin z
PDB Compounds: (B:) Aquaporin Z

SCOPe Domain Sequences for d1rc2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rc2b_ f.19.1.1 (B:) Aquaporin Z {Escherichia coli [TaxId: 562]}
mfrklaaecfgtfwlvfggcgsavlaagfpelgigfagvalafgltvltmafavghisgg
hfnpavtiglwaggrfpakevvgyviaqvvggivaaallyliasgktgfdaaasgfasng
ygehspggysmlsalvvelvlsagfllvihgatdkfapagfapiaiglaltlihlisipv
tntsvnparstavaifqggwaleqlwffwvvpivggiiggliyrtllekrd

SCOPe Domain Coordinates for d1rc2b_:

Click to download the PDB-style file with coordinates for d1rc2b_.
(The format of our PDB-style files is described here.)

Timeline for d1rc2b_: