Class f: Membrane and cell surface proteins and peptides [56835] (42 folds) |
Fold f.19: Aquaporin-like [81339] (1 superfamily) core: 8 helices, 2 short helices are surrounded by 6 long transmembrane helices |
Superfamily f.19.1: Aquaporin-like [81338] (1 family) |
Family f.19.1.1: Aquaporin-like [56895] (4 proteins) duplication: consist of two similar structural parts |
Protein Aquaporin Z [103470] (1 species) |
Species Escherichia coli [TaxId:562] [103471] (1 PDB entry) |
Domain d1rc2b_: 1rc2 B: [97282] complexed with bgl |
PDB Entry: 1rc2 (more details), 2.5 Å
SCOP Domain Sequences for d1rc2b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rc2b_ f.19.1.1 (B:) Aquaporin Z {Escherichia coli} mfrklaaecfgtfwlvfggcgsavlaagfpelgigfagvalafgltvltmafavghisgg hfnpavtiglwaggrfpakevvgyviaqvvggivaaallyliasgktgfdaaasgfasng ygehspggysmlsalvvelvlsagfllvihgatdkfapagfapiaiglaltlihlisipv tntsvnparstavaifqggwaleqlwffwvvpivggiiggliyrtllekrd
Timeline for d1rc2b_: