Lineage for d1r7ab2 (1r7a B:1-434)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 473233Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 474052Superfamily c.1.8: (Trans)glycosidases [51445] (11 families) (S)
  5. 474053Family c.1.8.1: Amylase, catalytic domain [51446] (24 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 474403Protein Sucrose phosphorylase [102060] (1 species)
    sequence and close structural relationship to amylosucrase; variations in the C-terminal domain fold
  7. 474404Species Bifidobacterium adolescentis [TaxId:1680] [102061] (1 PDB entry)
  8. 474406Domain d1r7ab2: 1r7a B:1-434 [97195]
    Other proteins in same PDB: d1r7aa1, d1r7ab1

Details for d1r7ab2

PDB Entry: 1r7a (more details), 1.77 Å

PDB Description: Sucrose Phosphorylase from Bifidobacterium adolescentis

SCOP Domain Sequences for d1r7ab2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r7ab2 c.1.8.1 (B:1-434) Sucrose phosphorylase {Bifidobacterium adolescentis}
mknkvqlityadrlgdgtiksmtdilrtrfdgvydgvhilpfftpfdgadagfdpidhtk
vderlgswddvaelskthnimvdaivnhmsweskqfqdvlakgeeseyypmfltmssvfp
ngateedlagiyrprpglpfthykfagktrlvwvsftpqqvdidtdsdkgweylmsifdq
maashvsyirldavgygakeagtscfmtpktfklisrlreegvkrgleilievhsyykkq
veiaskvdrvydfalpplllhalstghvepvahwtdirpnnavtvldthdgigvidigsd
qldrslkglvpdedvdnlvntihanthgesqaatgaaasnldlyqvnstyysalgcndqh
yiaaravqfflpgvpqvyyvgalagkndmellrktnngrdinrhyystaeidenlkrpvv
kalnalakfrneld

SCOP Domain Coordinates for d1r7ab2:

Click to download the PDB-style file with coordinates for d1r7ab2.
(The format of our PDB-style files is described here.)

Timeline for d1r7ab2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1r7ab1