SCOP 1.67: Domain d1r7ab2: 1r7a B:1-434

Lineage for d1r7ab2 (1r7a B:1-434)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (10 families)

5. Family c.1.8.1: Amylase, catalytic domain [51446] (24 proteins)
   members of the family may contain various insert subdomains
   in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain

6. Protein Sucrose phosphorylase [102060] (1 species)
   sequence and close structural relationship to amylosucrase; variations in the C-terminal domain fold

7. Species Bifidobacterium adolescentis [TaxId:1680] [102061] (1 PDB entry)

8. Domain d1r7ab2: 1r7a B:1-434 [97195]
   Other proteins in same PDB: d1r7aa1, d1r7ab1
   complexed with trs

Details for d1r7ab2

PDB Entry: 1r7a, 1.77 Å

PDB Description: Sucrose Phosphorylase from Bifidobacterium adolescentis

SCOP Domain Sequences for d1r7ab2:

Sequence; same for both SEQRES and ATOM records:

>d1r7ab2 c.1.8.1 (B:1-434) Sucrose phosphorylase {Bifidobacterium adolescentis}
mknkvqlityadrlgdgtiksmtdilrtrfdgvydgvhilpfftpfdgadagfdpidhtk
vderlgswddvaelskthnimvdaivnhmsweskqfqdvlakgeeseyypmfltmssvfp
ngateedlagiyrprpglpfthykfagktrlvwvsftpqqvdidtdsdkgweylmsifdq
maashvsyirldavgygakeagtscfmtpktfklisrlreegvkrgleilievhsyykkq
veiaskvdrvydfalpplllhalstghvepvahwtdirpnnavtvldthdgigvidigsd
qldrslkglvpdedvdnlvntihanthgesqaatgaaasnldlyqvnstyysalgcndqh
yiaaravqfflpgvpqvyyvgalagkndmellrktnngrdinrhyystaeidenlkrpvv
kalnalakfrneld

Timeline for d1r7ab2:

• d1r7ab2 is new in SCOP 1.67
  
• d1r7ab2 appears in SCOP 1.69
  
• d1r7ab2 appears in the current release, SCOPe 2.08