Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (10 families) |
Family c.1.8.1: Amylase, catalytic domain [51446] (24 proteins) members of the family may contain various insert subdomains in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain |
Protein Sucrose phosphorylase [102060] (1 species) sequence and close structural relationship to amylosucrase; variations in the C-terminal domain fold |
Species Bifidobacterium adolescentis [TaxId:1680] [102061] (1 PDB entry) |
Domain d1r7ab2: 1r7a B:1-434 [97195] Other proteins in same PDB: d1r7aa1, d1r7ab1 complexed with trs |
PDB Entry: 1r7a (more details), 1.77 Å
SCOP Domain Sequences for d1r7ab2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r7ab2 c.1.8.1 (B:1-434) Sucrose phosphorylase {Bifidobacterium adolescentis} mknkvqlityadrlgdgtiksmtdilrtrfdgvydgvhilpfftpfdgadagfdpidhtk vderlgswddvaelskthnimvdaivnhmsweskqfqdvlakgeeseyypmfltmssvfp ngateedlagiyrprpglpfthykfagktrlvwvsftpqqvdidtdsdkgweylmsifdq maashvsyirldavgygakeagtscfmtpktfklisrlreegvkrgleilievhsyykkq veiaskvdrvydfalpplllhalstghvepvahwtdirpnnavtvldthdgigvidigsd qldrslkglvpdedvdnlvntihanthgesqaatgaaasnldlyqvnstyysalgcndqh yiaaravqfflpgvpqvyyvgalagkndmellrktnngrdinrhyystaeidenlkrpvv kalnalakfrneld
Timeline for d1r7ab2: