SCOPe 2.08: Domain d1r5vc2: 1r5v C:3-81

Lineage for d1r5vc2 (1r5v C:3-81)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)

7. Species Mouse (Mus musculus), I-EK [TaxId:10090] [88814] (9 PDB entries)

8. Domain d1r5vc2: 1r5v C:3-81 [97121]
   Other proteins in same PDB: d1r5va1, d1r5vb1, d1r5vb2, d1r5vb3, d1r5vc1, d1r5vd1, d1r5vd2, d1r5vd3
   fragment; missing more than one-third of the common structure and/or sequence

Details for d1r5vc2

PDB Entry: 1r5v, 2.5 Å

PDB Description: evidence that structural rearrangements and/or flexibility during tcr binding can contribute to t-cell activation

PDB Compounds: (C:) H-2 class II histocompatibility antigen, E-K alpha chain

SCOPe Domain Sequences for d1r5vc2:

Sequence; same for both SEQRES and ATOM records:

>d1r5vc2 d.19.1.1 (C:3-81) Class II MHC alpha chain, N-terminal domain {Mouse (Mus musculus), I-EK [TaxId: 10090]}
eehtiiqaefyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgalan
iavdkanldvmkersnntp

Timeline for d1r5vc2:

• d1r5vc2 first appeared in SCOP 1.67
  
• d1r5vc2 appears in SCOPe 2.07