![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
![]() | Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species) |
![]() | Species Mouse (Mus musculus), I-EK [TaxId:10090] [88814] (9 PDB entries) |
![]() | Domain d1r5va2: 1r5v A:3-81 [97117] Other proteins in same PDB: d1r5va1, d1r5vb1, d1r5vb2, d1r5vb3, d1r5vc1, d1r5vd1, d1r5vd2, d1r5vd3 fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 1r5v (more details), 2.5 Å
SCOPe Domain Sequences for d1r5va2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r5va2 d.19.1.1 (A:3-81) Class II MHC alpha chain, N-terminal domain {Mouse (Mus musculus), I-EK [TaxId: 10090]} eehtiiqaefyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgalan iavdkanldvmkersnntp
Timeline for d1r5va2: