SCOPe 2.08: Domain d1r5vc1: 1r5v C:82-182

Lineage for d1r5vc1 (1r5v C:82-182)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class II MHC alpha chain, C-terminal domain [88618] (7 species)

7. Species Mouse (Mus musculus), I-E group [TaxId:10090] [88622] (9 PDB entries)
   probably orthologous to the human HLA-DR group

8. Domain d1r5vc1: 1r5v C:82-182 [97120]
   Other proteins in same PDB: d1r5va2, d1r5vb1, d1r5vb2, d1r5vb3, d1r5vc2, d1r5vd1, d1r5vd2, d1r5vd3

Details for d1r5vc1

PDB Entry: 1r5v, 2.5 Å

PDB Description: evidence that structural rearrangements and/or flexibility during tcr binding can contribute to t-cell activation

PDB Compounds: (C:) H-2 class II histocompatibility antigen, E-K alpha chain

SCOPe Domain Sequences for d1r5vc1:

Sequence; same for both SEQRES and ATOM records:

>d1r5vc1 b.1.1.2 (C:82-182) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-E group [TaxId: 10090]}
danvapevtvlsrspvnlgepnilicfidkfsppvvnvtwlrngrpvtegvsetvflprd
dhlfrkfhyltflpstddfydcevdhwgleeplrkhwefee

Timeline for d1r5vc1:

• d1r5vc1 first appeared in SCOP 1.67
  
• d1r5vc1 appears in SCOPe 2.07