Lineage for d1r5la1 (1r5l A:25-90)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 352395Fold a.5: RuvA C-terminal domain-like [46928] (6 superfamilies)
    3 helices; bundle, right-handed twist
  4. 352463Superfamily a.5.3: CRAL/TRIO N-terminal domain [46938] (1 family) (S)
  5. 352464Family a.5.3.1: CRAL/TRIO N-terminal domain [46939] (3 proteins)
  6. 352465Protein Alpha-tocopherol transfer protein [101069] (1 species)
  7. 352466Species Human (Homo sapiens) [TaxId:9606] [101070] (3 PDB entries)
  8. 352467Domain d1r5la1: 1r5l A:25-90 [97099]
    Other proteins in same PDB: d1r5la2
    complexed with viv

Details for d1r5la1

PDB Entry: 1r5l (more details), 1.5 Å

PDB Description: Crystal Structure of Human Alpha-Tocopherol Transfer Protein Bound to its Ligand

SCOP Domain Sequences for d1r5la1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r5la1 a.5.3.1 (A:25-90) Alpha-tocopherol transfer protein {Human (Homo sapiens)}
qpglaalrrrareagvplaplpltdsfllrflrardfdldlawrllknyykwraecpeis
adlhpr

SCOP Domain Coordinates for d1r5la1:

Click to download the PDB-style file with coordinates for d1r5la1.
(The format of our PDB-style files is described here.)

Timeline for d1r5la1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1r5la2