Lineage for d1r5la1 (1r5l A:25-90)
- Root: SCOP 1.67
Class a: All alpha proteins [46456] (202 folds) 
Fold a.5: RuvA C-terminal domain-like [46928] (6 superfamilies)
3 helices; bundle, right-handed twist
Superfamily a.5.3: CRAL/TRIO N-terminal domain [46938] (1 family) 
Family a.5.3.1: CRAL/TRIO N-terminal domain [46939] (3 proteins) Protein Alpha-tocopherol transfer protein [101069] (1 species) Species Human (Homo sapiens) [TaxId:9606] [101070] (3 PDB entries) 
Domain d1r5la1: 1r5l A:25-90 [97099]
Other proteins in same PDB: d1r5la2
complexed with viv
Details for d1r5la1
PDB Entry: 1r5l (more details), 1.5 Å
PDB Description: Crystal Structure of Human Alpha-Tocopherol Transfer Protein Bound to its Ligand
SCOP Domain Sequences for d1r5la1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r5la1 a.5.3.1 (A:25-90) Alpha-tocopherol transfer protein {Human (Homo sapiens)}
qpglaalrrrareagvplaplpltdsfllrflrardfdldlawrllknyykwraecpeis
adlhpr
SCOP Domain Coordinates for d1r5la1:
Click to download the PDB-style file with coordinates for d1r5la1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1r5la1:
- d1r5la1 is new in SCOP 1.67
- d1r5la1 appears in SCOP 1.69
- d1r5la1 appears in the current release, SCOPe 2.08
View in 3D