PDB entry 1r5l

View 1r5l on RCSB PDB site
Description: Crystal Structure of Human Alpha-Tocopherol Transfer Protein Bound to its Ligand
Deposited on 2003-10-10, released 2003-11-25
The last revision prior to the SCOP 1.67 freeze date was dated 2003-12-16, with a file datestamp of 2003-12-16.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.187
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r5lA (A:)
    gshmspllqpglaalrrrareagvplaplpltdsfllrflrardfdldlawrllknyykw
    raecpeisadlhprsiigllkagyhgvlrsrdptgskvliyriahwdpkvftaydvfrvs
    litselivqevetqrngikaifdlegwqfshafqitpsvakkiaavltdsfplkvrgihl
    inepvifhavfsmikpfltekikerihmhgnnykqsllqhfpdilpleyggeefsmedic
    qewtnfimksedylssisesiq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r5lA (A:)
    qpglaalrrrareagvplaplpltdsfllrflrardfdldlawrllknyykwraecpeis
    adlhprsiigllkagyhgvlrsrdptgskvliyriahwdpkvftaydvfrvslitseliv
    qevetqrngikaifdlegwqfshafqitpsvakkiaavltdsfplkvrgihlinepvifh
    avfsmikpfltekikerihmhgnnykqsllqhfpdilpleyggeefsmedicqewtnfim
    ksedylssise