SCOPe 2.08: Domain d1r5la1: 1r5l A:25-90

Lineage for d1r5la1 (1r5l A:25-90)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
   3 helices; bundle, right-handed twist

4. Superfamily a.5.3: CRAL/TRIO N-terminal domain [46938] (2 families)

5. Family a.5.3.1: CRAL/TRIO N-terminal domain [46939] (3 proteins)

6. Protein Alpha-tocopherol transfer protein [101069] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101070] (3 PDB entries)

8. Domain d1r5la1: 1r5l A:25-90 [97099]
   Other proteins in same PDB: d1r5la2
   complexed with viv

Details for d1r5la1

PDB Entry: 1r5l, 1.5 Å

PDB Description: Crystal Structure of Human Alpha-Tocopherol Transfer Protein Bound to its Ligand

PDB Compounds: (A:) PROTEIN (Alpha-tocopherol transfer protein)

SCOPe Domain Sequences for d1r5la1:

Sequence; same for both SEQRES and ATOM records:

>d1r5la1 a.5.3.1 (A:25-90) Alpha-tocopherol transfer protein {Human (Homo sapiens) [TaxId: 9606]}
qpglaalrrrareagvplaplpltdsfllrflrardfdldlawrllknyykwraecpeis
adlhpr

Timeline for d1r5la1:

• d1r5la1 first appeared in SCOP 1.67
  
• d1r5la1 appears in SCOPe 2.07