Lineage for d1r5aa2 (1r5a A:2-86)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1168056Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1168057Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1168419Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins)
  6. 1168561Protein Class delta GST [81366] (5 species)
    formerly a part of class theta enzymes
  7. 1168575Species Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId:123217] [102439] (1 PDB entry)
  8. 1168576Domain d1r5aa2: 1r5a A:2-86 [97082]
    Other proteins in same PDB: d1r5aa1
    complexed with cu, gts

Details for d1r5aa2

PDB Entry: 1r5a (more details), 2.5 Å

PDB Description: Glutathione S-transferase
PDB Compounds: (A:) glutathione transferase

SCOPe Domain Sequences for d1r5aa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r5aa2 c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]}
ttvlyylpasppcrsvlllakmigveldlkvlnimegeqlkpdfvelnpqhciptmddhg
lvlwesrvilsylvsaygkdenlyp

SCOPe Domain Coordinates for d1r5aa2:

Click to download the PDB-style file with coordinates for d1r5aa2.
(The format of our PDB-style files is described here.)

Timeline for d1r5aa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1r5aa1