| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins) |
| Protein Class delta GST [81366] (6 species) formerly a part of class theta enzymes |
| Species Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId:123217] [102439] (1 PDB entry) |
| Domain d1r5aa2: 1r5a A:2-86 [97082] Other proteins in same PDB: d1r5aa1 complexed with cu, gts |
PDB Entry: 1r5a (more details), 2.5 Å
SCOPe Domain Sequences for d1r5aa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r5aa2 c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]}
ttvlyylpasppcrsvlllakmigveldlkvlnimegeqlkpdfvelnpqhciptmddhg
lvlwesrvilsylvsaygkdenlyp
Timeline for d1r5aa2: