SCOP 1.73: Domain d1r57a_: 1r57 A:

Lineage for d1r57a_ (1r57 A:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (9 families)

5. Family d.108.1.1: N-acetyl transferase, NAT [55730] (56 proteins)

6. Protein Hypothetical protein SA2309 [103173] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [103174] (2 PDB entries)

8. Domain d1r57a_: 1r57 A: [97080]
   structural genomics; NESG target ZR31

Details for d1r57a_

PDB Entry: 1r57

PDB Description: nmr solution structure of a gcn5-like putative n-acetyltransferase from staphylococcus aureus. northeast structural genomics consortium target zr31

PDB Compounds: (A:) conserved hypothetical protein

SCOP Domain Sequences for d1r57a_:

Sequence; same for both SEQRES and ATOM records:

>d1r57a_ d.108.1.1 (A:) Hypothetical protein SA2309 {Staphylococcus aureus [TaxId: 1280]}
msnleikqgenkfyigddennalaeityrfvdnneinidhtgvsdelggqgvgkkllkav
veharennlkiiascsfakhmlekedsyqdvylglehhhhhh

Timeline for d1r57a_:

• d1r57a_ first appeared in SCOP 1.67
  
• d1r57a_ appears in SCOP 1.71
  
• d1r57a_ appears in SCOP 1.75
  
• d1r57a_ appears in the current release, SCOPe 2.08, called d1r57a1