Lineage for d1r57a1 (1r57 A:1-94)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2533209Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2533210Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2533211Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 2533389Protein Hypothetical protein SA2309 [103173] (1 species)
  7. 2533390Species Staphylococcus aureus [TaxId:1280] [103174] (2 PDB entries)
  8. 2533391Domain d1r57a1: 1r57 A:1-94 [97080]
    Other proteins in same PDB: d1r57a2
    structural genomics; NESG target ZR31

Details for d1r57a1

PDB Entry: 1r57 (more details)

PDB Description: NMR Solution Structure of a GCN5-like putative N-acetyltransferase from Staphylococcus aureus. Northeast Structural Genomics Consortium Target ZR31
PDB Compounds: (A:) conserved hypothetical protein

SCOPe Domain Sequences for d1r57a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r57a1 d.108.1.1 (A:1-94) Hypothetical protein SA2309 {Staphylococcus aureus [TaxId: 1280]}
msnleikqgenkfyigddennalaeityrfvdnneinidhtgvsdelggqgvgkkllkav
veharennlkiiascsfakhmlekedsyqdvylg

SCOPe Domain Coordinates for d1r57a1:

Click to download the PDB-style file with coordinates for d1r57a1.
(The format of our PDB-style files is described here.)

Timeline for d1r57a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1r57a2