SCOPe 2.08: Domain d1r47a2: 1r47 A:32-323

Lineage for d1r47a2 (1r47 A:32-323)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
   members of the family may contain various insert subdomains
   in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain

6. Protein Melibiase [75064] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [102062] (21 PDB entries)
   alpha-galactosidase A

8. Domain d1r47a2: 1r47 A:32-323 [96978]
   Other proteins in same PDB: d1r47a1, d1r47b1
   complexed with edo, gal
   missing some secondary structures that made up less than one-third of the common domain

Details for d1r47a2

PDB Entry: 1r47, 3.45 Å

PDB Description: structure of human alpha-galactosidase

PDB Compounds: (A:) Alpha-galactosidase A

SCOPe Domain Sequences for d1r47a2:

Sequence; same for both SEQRES and ATOM records:

>d1r47a2 c.1.8.1 (A:32-323) Melibiase {Human (Homo sapiens) [TaxId: 9606]}
ldnglartptmgwlhwerfmcnldcqeepdsciseklfmemaelmvsegwkdagyeylci
ddcwmapqrdsegrlqadpqrfphgirqlanyvhskglklgiyadvgnktcagfpgsfgy
ydidaqtfadwgvdllkfdgcycdslenladgykhmslalnrtgrsivyscewplymwpf
qkpnyteirqycnhwrnfadiddswksiksildwtsfnqerivdvagpggwndpdmlvig
nfglswnqqvtqmalwaimaaplfmsndlrhispqakallqdkdviainqdp

Timeline for d1r47a2:

• d1r47a2 first appeared in SCOP 1.67
  
• d1r47a2 appears in SCOPe 2.07